PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00065381001
Common NameGSBRNA2T00065381001, LOC106423670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 399aa    MW: 44888.4 Da    PI: 9.4342
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00065381001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32216269255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  GSBRNA2T00065381001 216 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 269
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15213269IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28214269IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-24216269IPR006447Myb domain, plants
PfamPF002495.7E-7217268IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MSMEGVFLEK PKSNTTTTLP DLSLNISLPD THHHLHHNEL SRRSSQTDNN RSSNFELSLS  60
HHNNPSSNPS TRILHCPDPR NLNLSHHQHY NNPILNGRSL HQRVDESDIN NIHRPIRGIP  120
VYHNRSFPFH QQTSHSSSLG GGDLDQSSIL NSSSSYNNAY RSLQSSPRLK GVPVHHHNHY  180
GVVGSSDSSS PHHHHHGMIR SRLLPKMPTK RSMRAPRMRW TSSLHARFVH AVELLGGHER  240
ATPKSVLELM DVKDLTLAHV KSHLQMYRTV KTTNKPAASS DGSGEEEMGI NGNEAHHQSS  300
TNQRAKSDDS SHQEIDFPST QARWGNSSRE TWRSSNNCSS DIDTMVRTSS TPMISHHQRS  360
ILLNQEQRSN DQVKRCGDLS CNNPSLEFTL GRPDWHNT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.238941e-175vegetative meristem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00065381001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0301920.0AY030192.1 Arabidopsis thaliana clone A1-2 KANADI protein (KAN) mRNA, complete cds.
GenBankAY0486880.0AY048688.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI1 (KAN1) mRNA, complete cds.
GenBankBT0264360.0BT026436.1 Arabidopsis thaliana At5g16560 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013616379.10.0PREDICTED: transcription repressor KAN1-like
RefseqXP_013719895.10.0PREDICTED: transcription repressor KAN1-like
SwissprotQ93WJ90.0KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A078HI300.0A0A078HI30_BRANA; BnaC02g06680D protein
TrEMBLA0A0D3AJD10.0A0A0D3AJD1_BRAOL; Uncharacterized protein
STRINGAT5G16560.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.10.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]